PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009797678.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 177aa    MW: 20516.2 Da    PI: 9.3005
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009797678.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.84.5e-161662248
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                     +e+k  r+vtfskR++ ++ KA E S+ ++a+v v++fs++gk   
  XP_009797678.1 16 YVESKEARYVTFSKRKASLFRKADEFSTVTGADVGVLLFSPSGKPCS 62
                    5799***************************************9655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.2E-22766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.703767IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-23884IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-12929IPR002100Transcription factor, MADS-box
PfamPF003192.4E-191763IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-122944IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-124465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MARRTSRGRQ KIEMKYVESK EARYVTFSKR KASLFRKADE FSTVTGADVG VLLFSPSGKP  60
CSYTSTSVEK ITEKFREWKQ QNADEGKSSV FQAFDDLCKD IQDENEKAKS RELRYKVMYP  120
GAEIPADKER LEKFMEMKLR LENINEATKN HIRAERLKFD LNVVPEYEVG ESSGTHH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009797678.11e-130PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLM0ZZJ73e-69M0ZZJ7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000114271e-68(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17801260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.14e-20AGAMOUS-like 29